Glypican 6 protein (His tag) (80R-3484)

Purified recombinant Glypican 6 protein (His tag)

Synonyms Glypican-6 protein, Glypican6 protein
Species Human
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

Western blot analysis using Glypican 6 protein (His tag) (80R-3484)

Specifications

Residues DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEF ENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLF TELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDV PRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTV RPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAI MNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDR LVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQ INNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMD DVCPTEFEFVTTEAPAVDPDRREVDS
Expression System E.coli
Purity > 90% pure
Molecular Weight 60 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in aTris based bufferwith 50% glycerol

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance Glypican 6 is a cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Glypican 6 protein (His tag) (80R-3484)

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors