GMF gamma antibody (70R-6206)

Rabbit polyclonal GMF gamma antibody raised against the middle region of GMFG

Synonyms Polyclonal GMF gamma antibody, Anti-GMF gamma antibody, MGC126867 antibody, Glia Maturation Factor Gamma antibody, GMF-GAMMA antibody, GMFG antibody
Specificity GMF gamma antibody was raised against the middle region of GMFG
Cross Reactivity Human
Applications WB
Immunogen GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY
Assay Information GMF gamma Blocking Peptide, catalog no. 33R-4701, is also available for use as a blocking control in assays to test for specificity of this GMF gamma antibody

Images

Western Blot analysis using GMF gamma antibody (70R-6206)

GMF gamma antibody (70R-6206) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GMFG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GMF gamma protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GMF gamma antibody (70R-6206) | GMF gamma antibody (70R-6206) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors