GMPPB antibody (70R-1204)

Rabbit polyclonal GMPPB antibody raised against the C terminal of GMPPB

Synonyms Polyclonal GMPPB antibody, Anti-GMPPB antibody, Gdp-Mannose Pyrophosphorylase B antibody, KIAA1851 antibody
Specificity GMPPB antibody was raised against the C terminal of GMPPB
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen GMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM
Assay Information GMPPB Blocking Peptide, catalog no. 33R-7838, is also available for use as a blocking control in assays to test for specificity of this GMPPB antibody


Immunohistochemical staining using GMPPB antibody (70R-1204)

GMPPB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GMPPB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GMPPB is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GMPPB antibody (70R-1204) | GMPPB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GMPPB antibody (70R-1204) | GMPPB antibody (70R-1204) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using GMPPB antibody (70R-1204) | GMPPB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors