GNA15 antibody (70R-5809)

Rabbit polyclonal GNA15 antibody raised against the N terminal of GNA15

Synonyms Polyclonal GNA15 antibody, Anti-GNA15 antibody, GNA16 antibody, RNA guanine Nucleotide Binding Protein antibody, G Protein Alpha 15 antibody
Specificity GNA15 antibody was raised against the N terminal of GNA15
Cross Reactivity Human
Applications WB
Immunogen GNA15 antibody was raised using the N terminal of GNA15 corresponding to a region with amino acids ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG
Assay Information GNA15 Blocking Peptide, catalog no. 33R-1493, is also available for use as a blocking control in assays to test for specificity of this GNA15 antibody


Western Blot analysis using GNA15 antibody (70R-5809)

GNA15 antibody (70R-5809) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNA15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GNA15 antibody (70R-5809) | GNA15 antibody (70R-5809) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors