GNAI2 antibody (70R-5712)

Rabbit polyclonal GNAI2 antibody

Synonyms Polyclonal GNAI2 antibody, Anti-GNAI2 antibody, G Protein Alpha Inhibiting Activity Polypeptide 2 antibody, RNA guanine Nucleotide Binding Protein antibody, H_LUCA16.1 antibody, GIP antibody, GNAI2B antibody, H_LUCA15.1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA
Assay Information GNAI2 Blocking Peptide, catalog no. 33R-2830, is also available for use as a blocking control in assays to test for specificity of this GNAI2 antibody

Images

Western Blot analysis using GNAI2 antibody (70R-5712)

GNAI2 antibody (70R-5712) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNAI2 antibody (70R-5712) | GNAI2 antibody (70R-5712) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors