GNAO1 antibody (70R-5233)

Rabbit polyclonal GNAO1 antibody

Synonyms Polyclonal GNAO1 antibody, Anti-GNAO1 antibody, GNAO antibody, DKFZp686O0962 antibody, RNA guanine Nucleotide Binding Protein antibody, G Protein Alpha Activating Activity Polypeptide O antibody, G-ALPHA-o antibody
Cross Reactivity Human
Applications WB
Immunogen GNAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
Assay Information GNAO1 Blocking Peptide, catalog no. 33R-7429, is also available for use as a blocking control in assays to test for specificity of this GNAO1 antibody


Western Blot analysis using GNAO1 antibody (70R-5233)

GNAO1 antibody (70R-5233) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GNAO1 antibody (70R-5233) | GNAO1 antibody (70R-5233) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors