GNAQ antibody (70R-5722)

Rabbit polyclonal GNAQ antibody

Synonyms Polyclonal GNAQ antibody, Anti-GNAQ antibody, G Protein Alpha Q Polypeptide antibody, G-ALPHA-q antibody, RNA guanine Nucleotide Binding Protein antibody, GAQ antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
Assay Information GNAQ Blocking Peptide, catalog no. 33R-2030, is also available for use as a blocking control in assays to test for specificity of this GNAQ antibody

Images

Western blot analysis using GNAQ antibody (70R-5722)

Recommended GNAQ Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAQ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using GNAQ antibody (70R-5722) | Recommended GNAQ Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors