GNB1 antibody (70R-3118)

Rabbit polyclonal GNB1 antibody

Synonyms Polyclonal GNB1 antibody, Anti-GNB1 antibody, RNA guanine Nucleotide Binding Protein antibody, G Protein Beta Polypeptide 1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD
Assay Information GNB1 Blocking Peptide, catalog no. 33R-2064, is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody

Images

Western Blot analysis using GNB1 antibody (70R-3118)

GNB1 antibody (70R-3118) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNB1 antibody (70R-3118) | GNB1 antibody (70R-3118) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors