GNB1L antibody (70R-1642)

Rabbit polyclonal GNB1L antibody

Synonyms Polyclonal GNB1L antibody, Anti-GNB1L antibody, RNA guanine Nucleotide Binding Protein antibody, G Protein Beta Polypeptide 1-Like antibody
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen GNB1L antibody was raised using a synthetic peptide corresponding to a region with amino acids RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA
Assay Information GNB1L Blocking Peptide, catalog no. 33R-8245, is also available for use as a blocking control in assays to test for specificity of this GNB1L antibody

Images

Western Blot analysis using GNB1L antibody (70R-1642)

GNB1L antibody (70R-1642) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GNB1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNB1L antibody (70R-1642) | GNB1L antibody (70R-1642) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using GNB1L antibody (70R-1642) | GNB1L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors