GNB2L1 antibody (70R-5893)

Rabbit polyclonal GNB2L1 antibody

Synonyms Polyclonal GNB2L1 antibody, Anti-GNB2L1 antibody, PIG21 antibody, HLC-7 antibody, RACK1 antibody, Gnb2-rs1 antibody, G Protein Beta Polypeptide 2-Like 1 antibody, RNA guanine Nucleotide Binding Protein antibody, H12.3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GNB2L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI
Assay Information GNB2L1 Blocking Peptide, catalog no. 33R-4165, is also available for use as a blocking control in assays to test for specificity of this GNB2L1 antibody

Images

Western Blot analysis using GNB2L1 antibody (70R-5893)

GNB2L1 antibody (70R-5893) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNB2L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNB2L1 antibody (70R-5893) | GNB2L1 antibody (70R-5893) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors