GNGT2 antibody (70R-3637)

Rabbit polyclonal GNGT2 antibody raised against the middle region of Gngt2

Synonyms Polyclonal GNGT2 antibody, Anti-GNGT2 antibody, GNG8 antibody, G-GAMMA-C antibody, G-GAMMA-8 antibody, GNGT8 antibody, GNG9 antibody
Specificity GNGT2 antibody was raised against the middle region of Gngt2
Cross Reactivity Human
Applications WB
Immunogen GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Assay Information GNGT2 Blocking Peptide, catalog no. 33R-4362, is also available for use as a blocking control in assays to test for specificity of this GNGT2 antibody

Images

Western Blot analysis using GNGT2 antibody (70R-3637)

GNGT2 antibody (70R-3637) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 8 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNGT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNGT2 antibody (70R-3637) | GNGT2 antibody (70R-3637) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors