GNPDA1 antibody (70R-3271)

Rabbit polyclonal GNPDA1 antibody raised against the C terminal of GNPDA1

Synonyms Polyclonal GNPDA1 antibody, Anti-GNPDA1 antibody, GNPDA antibody, Glucosamine-6-Phosphate Deaminase 1 antibody, GNPI antibody, GPI antibody, KIAA0060 antibody, HLN antibody
Specificity GNPDA1 antibody was raised against the C terminal of GNPDA1
Cross Reactivity Human,Mouse,Rat,C.elegans
Applications WB
Immunogen GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD
Assay Information GNPDA1 Blocking Peptide, catalog no. 33R-2449, is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody

Images

Western Blot analysis using GNPDA1 antibody (70R-3271)

GNPDA1 antibody (70R-3271) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNPDA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNPDA1 antibody (70R-3271) | GNPDA1 antibody (70R-3271) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors