GOLGA5 antibody (70R-6969)

Rabbit polyclonal GOLGA5 antibody raised against the N terminal of GOLGA5

Synonyms Polyclonal GOLGA5 antibody, Anti-GOLGA5 antibody, GOLIM5 antibody, Golgi Autoantigen Golgin Subfamily A 5 antibody, RFG5 antibody, ret-II antibody
Specificity GOLGA5 antibody was raised against the N terminal of GOLGA5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS
Assay Information GOLGA5 Blocking Peptide, catalog no. 33R-3120, is also available for use as a blocking control in assays to test for specificity of this GOLGA5 antibody

Images

Western Blot analysis using GOLGA5 antibody (70R-6969)

GOLGA5 antibody (70R-6969) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GOLGA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GOLGA5 antibody (70R-6969) | GOLGA5 antibody (70R-6969) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors