GOLGB1 antibody (70R-6855)

Rabbit polyclonal GOLGB1 antibody raised against the N terminal of GOLGB1

Synonyms Polyclonal GOLGB1 antibody, Anti-GOLGB1 antibody, GIANTIN antibody, Golgin B1 Golgi Integral Membrane Protein antibody, GCP372 antibody, GCP antibody, GOLIM1 antibody
Specificity GOLGB1 antibody was raised against the N terminal of GOLGB1
Cross Reactivity Human
Applications WB
Immunogen GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
Assay Information GOLGB1 Blocking Peptide, catalog no. 33R-6750, is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody

Images

Western Blot analysis using GOLGB1 antibody (70R-6855)

GOLGB1 antibody (70R-6855) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 376 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GOLGB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GOLGB1 antibody (70R-6855) | GOLGB1 antibody (70R-6855) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors