GOLM1 antibody (70R-7413)

Rabbit polyclonal GOLM1 antibody raised against the N terminal of GOLM1

Synonyms Polyclonal GOLM1 antibody, Anti-GOLM1 antibody, PSEC0257 antibody, GP73 antibody, Golgi Membrane Protein 1 antibody, bA379P1.3 antibody, FLJ22634 antibody, GOLPH2 antibody, FLJ23608 antibody, C9orf155 antibody
Specificity GOLM1 antibody was raised against the N terminal of GOLM1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GOLM1 antibody was raised using the N terminal of GOLM1 corresponding to a region with amino acids RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS
Assay Information GOLM1 Blocking Peptide, catalog no. 33R-8215, is also available for use as a blocking control in assays to test for specificity of this GOLM1 antibody


WB analysis of GOLM1 antibody (70R-7413)

Western Blot of human brain using GOLM1 antibody at 1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GOLM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GOLM1 is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • WB analysis of GOLM1 antibody (70R-7413) | Western Blot of human brain using GOLM1 antibody at 1 ug/ml
  • Western blot analysis using GOLM1 antibody (70R-7413) | Recommended GOLM1 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using GOLM1 antibody (70R-7413) | Tissue analyzed: Human Hela; Antibody Dilution: 1.0ug/ml
  • WB analysis of GOLM1 antibody (70R-7413) | Western Blot of human brain using GOLM1 antibody at 1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors