GORASP1 antibody (70R-3717)

Rabbit polyclonal GORASP1 antibody raised against the N terminal of GORASP1

Synonyms Polyclonal GORASP1 antibody, Anti-GORASP1 antibody, Golgi Reassembly Stacking Protein 1 65Kda antibody, FLJ23443 antibody, MGC118897 antibody, P65 antibody, MGC118894 antibody, GRASP65 antibody, GOLPH5 antibody
Specificity GORASP1 antibody was raised against the N terminal of GORASP1
Cross Reactivity Human
Applications WB
Immunogen GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV
Assay Information GORASP1 Blocking Peptide, catalog no. 33R-7444, is also available for use as a blocking control in assays to test for specificity of this GORASP1 antibody


Western Blot analysis using GORASP1 antibody (70R-3717)

GORASP1 antibody (70R-3717) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GORASP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GORASP1 antibody (70R-3717) | GORASP1 antibody (70R-3717) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors