GOT1 antibody (70R-2522)

Rabbit polyclonal GOT1 antibody

Synonyms Polyclonal GOT1 antibody, Anti-GOT1 antibody, Aspartate Aminotransferase 1 antibody, GIG18 antibody, Glutamic-Oxaloacetic Transaminase 1 Soluble antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Assay Information GOT1 Blocking Peptide, catalog no. 33R-5714, is also available for use as a blocking control in assays to test for specificity of this GOT1 antibody

Images

Western Blot analysis using GOT1 antibody (70R-2522)

GOT1 antibody (70R-2522) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GOT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GOT1 antibody (70R-2522) | GOT1 antibody (70R-2522) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors