GOT2 antibody (70R-1561)

Rabbit polyclonal GOT2 antibody

Synonyms Polyclonal GOT2 antibody, Anti-GOT2 antibody, FLJ40994 antibody, Glutamic-Oxaloacetic Transaminase 2 Mitochondrial antibody, mitaat antibody, kat4 antibody, Aspartate Aminotransferase 2 antibody, kativ antibody
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications WB
Immunogen GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA
Assay Information GOT2 Blocking Peptide, catalog no. 33R-7247, is also available for use as a blocking control in assays to test for specificity of this GOT2 antibody

Images

Western Blot analysis using GOT2 antibody (70R-1561)

GOT2 antibody (70R-1561) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GOT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GOT2 antibody (70R-1561) | GOT2 antibody (70R-1561) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors