GPAA1 antibody (70R-7292)

Rabbit polyclonal GPAA1 antibody

Synonyms Polyclonal GPAA1 antibody, Anti-GPAA1 antibody, hGAA1 antibody, GAA1 antibody, Glycosylphosphatidylinositol Anchor Attachment Protein 1 Homolog antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen GPAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
Assay Information GPAA1 Blocking Peptide, catalog no. 33R-4996, is also available for use as a blocking control in assays to test for specificity of this GPAA1 antibody

Images

Immunohistochemical staining using GPAA1 antibody (70R-7292)

GPAA1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPAA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using GPAA1 antibody (70R-7292) | GPAA1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using GPAA1 antibody (70R-7292) | GPAA1 antibody (70R-7292) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors