GPCR5A antibody (70R-6472)

Rabbit polyclonal GPCR5A antibody raised against the C terminal Of Gpcr5A

Synonyms Polyclonal GPCR5A antibody, Anti-GPCR5A antibody, RAIG1 antibody, GPRC5A antibody, RAI3 antibody
Specificity GPCR5A antibody was raised against the C terminal Of Gpcr5A
Cross Reactivity Human,Mouse
Applications WB
Immunogen GPCR5A antibody was raised using the C terminal Of Gpcr5A corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
Assay Information GPCR5A Blocking Peptide, catalog no. 33R-8711, is also available for use as a blocking control in assays to test for specificity of this GPCR5A antibody

Images

Western Blot analysis using GPCR5A antibody (70R-6472)

GPCR5A antibody (70R-6472) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPCR5A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPCR5A antibody (70R-6472) | GPCR5A antibody (70R-6472) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors