GPD2 antibody (70R-7254)

Rabbit polyclonal GPD2 antibody

Synonyms Polyclonal GPD2 antibody, Anti-GPD2 antibody, mGPDH antibody, GDH2 antibody, Glycerol-3-Phosphate Dehydrogenase 2 antibody
Cross Reactivity Human
Applications WB
Immunogen GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG
Assay Information GPD2 Blocking Peptide, catalog no. 33R-3516, is also available for use as a blocking control in assays to test for specificity of this GPD2 antibody


Western Blot analysis using GPD2 antibody (70R-7254)

GPD2 antibody (70R-7254) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GPD2 antibody (70R-7254) | GPD2 antibody (70R-7254) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors