GPR161 antibody (70R-1845)

Rabbit polyclonal GPR161 antibody raised against the N terminal of GPR161

Synonyms Polyclonal GPR161 antibody, Anti-GPR161 antibody, GPR 161 antibody, GPR161, GPR 161, GPR-161 antibody, G Protein-Coupled Receptor 161 antibody, GPR-161, FLJ33952 antibody, RE2 antibody
Specificity GPR161 antibody was raised against the N terminal of GPR161
Cross Reactivity Human
Applications IHC, WB
Immunogen GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV
Assay Information GPR161 Blocking Peptide, catalog no. 33R-6464, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody

Images

Western Blot analysis using GPR161 antibody (70R-1845)

GPR161 antibody (70R-1845) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GPR161 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPR161 is orphan receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPR161 antibody (70R-1845) | GPR161 antibody (70R-1845) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors