GPR161 antibody (70R-7067)

Rabbit polyclonal GPR161 antibody raised against the middle region of GPR161

Synonyms Polyclonal GPR161 antibody, Anti-GPR161 antibody, GPR-161 antibody, GPR 161, GPR161, FLJ33952 antibody, GPR 161 antibody, GPR-161, G Protein-Coupled Receptor 161 antibody, RE2 antibody
Specificity GPR161 antibody was raised against the middle region of GPR161
Cross Reactivity Human
Applications IHC, WB
Immunogen GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG
Assay Information GPR161 Blocking Peptide, catalog no. 33R-2995, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody

Images

Immunohistochemical staining using GPR161 antibody (70R-7067)

GPR161 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR161 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPR161 is Orphan receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using GPR161 antibody (70R-7067) | GPR161 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using GPR161 antibody (70R-7067) | GPR161 antibody (70R-7067) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors