GPR177 antibody (70R-5945)

Rabbit polyclonal GPR177 antibody raised against the middle region of GPR177

Synonyms Polyclonal GPR177 antibody, Anti-GPR177 antibody, EVI antibody, GPR-177 antibody, GPR-177, GPR 177 antibody, MRP antibody, GPR 177, GPR177, MGC14878 antibody, FLJ23091 antibody, C1orf139 antibody, WLS antibody, MGC131760 antibody, G Protein-Coupled Receptor 177 antibody
Specificity GPR177 antibody was raised against the middle region of GPR177
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE
Assay Information GPR177 Blocking Peptide, catalog no. 33R-2005, is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Images

Western Blot analysis using GPR177 antibody (70R-5945)

GPR177 antibody (70R-5945) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR177 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPR177 antibody (70R-5945) | GPR177 antibody (70R-5945) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors