GPR177 antibody (70R-6560)

Rabbit polyclonal GPR177 antibody raised against the N terminal of GPR177

Synonyms Polyclonal GPR177 antibody, Anti-GPR177 antibody, C1orf139 antibody, GPR177, GPR 177 antibody, GPR 177, FLJ23091 antibody, MRP antibody, MGC14878 antibody, MGC131760 antibody, EVI antibody, G Protein-Coupled Receptor 177 antibody, RP11-518D3.2 antibody, GPR-177, GPR-177 antibody, WLS antibody
Specificity GPR177 antibody was raised against the N terminal of GPR177
Cross Reactivity Human, Mouse, Dog
Applications IHC, WB
Immunogen GPR177 antibody was raised using the N terminal of GPR177 corresponding to a region with amino acids ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME
Assay Information GPR177 Blocking Peptide, catalog no. 33R-1477, is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Images

Immunohistochemical staining using GPR177 antibody (70R-6560)

GPR177 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR177 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPR177 is a receptor for Wnt proteins in Wnt-secreting cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using GPR177 antibody (70R-6560) | GPR177 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GPR177 antibody (70R-6560) | GPR177 antibody (70R-6560) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using GPR177 antibody (70R-6560) | GPR177 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors