GPR27 antibody (70R-7335)

Rabbit polyclonal GPR27 antibody raised against the middle region of GPR27

Synonyms Polyclonal GPR27 antibody, Anti-GPR27 antibody, SREB1 antibody, GPR-27 antibody, GPR 27 antibody, GPR 27, G Protein-Coupled Receptor 27 antibody, GPR27, GPR-27
Specificity GPR27 antibody was raised against the middle region of GPR27
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV
Assay Information GPR27 Blocking Peptide, catalog no. 33R-1617, is also available for use as a blocking control in assays to test for specificity of this GPR27 antibody

Images

Western Blot analysis using GPR27 antibody (70R-7335)

GPR27 antibody (70R-7335) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR27 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPR27 belongs to the G-protein coupled receptor 1 family. GPR27 is an orphan receptor. It is a possible candidate for amine-like G-protein coupled receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPR27 antibody (70R-7335) | GPR27 antibody (70R-7335) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors