GPR56 antibody (70R-7463)

Rabbit polyclonal GPR56 antibody raised against the N terminal of GPR56

Synonyms Polyclonal GPR56 antibody, Anti-GPR56 antibody, GPR-56 antibody, GPR 56 antibody, GPR 56, DKFZp781L1398 antibody, GPR56, TM7XN1 antibody, G Protein-Coupled Receptor 56 antibody, GPR-56, TM7LN4 antibody, BFPP antibody
Specificity GPR56 antibody was raised against the N terminal of GPR56
Cross Reactivity Human
Applications WB
Immunogen GPR56 antibody was raised using the N terminal of GPR56 corresponding to a region with amino acids MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
Assay Information GPR56 Blocking Peptide, catalog no. 33R-5594, is also available for use as a blocking control in assays to test for specificity of this GPR56 antibody

Images

Western Blot analysis using GPR56 antibody (70R-7463)

GPR56 antibody (70R-7463) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR56 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPR56 could be involved in cell-cell interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPR56 antibody (70R-7463) | GPR56 antibody (70R-7463) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors