GPR75 antibody (70R-6305)

Rabbit polyclonal GPR75 antibody raised against the middle region of GPR75

Synonyms Polyclonal GPR75 antibody, Anti-GPR75 antibody, GPR-75 antibody, GPR75, WI-31133 antibody, GPR-75, GPR 75 antibody, G Protein-Coupled Receptor 75 antibody, GPR 75, GPR-chr2 antibody
Specificity GPR75 antibody was raised against the middle region of GPR75
Cross Reactivity Human
Applications WB
Immunogen GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS
Assay Information GPR75 Blocking Peptide, catalog no. 33R-7365, is also available for use as a blocking control in assays to test for specificity of this GPR75 antibody

Images

Western Blot analysis using GPR75 antibody (70R-6305)

GPR75 antibody (70R-6305) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR75 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPR75 is an orphan receptor.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPR75 antibody (70R-6305) | GPR75 antibody (70R-6305) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors