GPR87 antibody (70R-3377)

Rabbit polyclonal GPR87 antibody raised against the middle region of GPR87

Synonyms Polyclonal GPR87 antibody, Anti-GPR87 antibody, FKSG78 antibody, GPR95 antibody, GPR87, MGC131898 antibody, GPR-87, GPR-87 antibody, G Protein-Coupled Receptor 87 antibody, KPG_002 antibody, GPR 87, GPR 87 antibody
Specificity GPR87 antibody was raised against the middle region of GPR87
Cross Reactivity Human
Applications WB
Immunogen GPR87 antibody was raised using the middle region of GPR87 corresponding to a region with amino acids NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
Assay Information GPR87 Blocking Peptide, catalog no. 33R-6845, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody

Images

Western Blot analysis using GPR87 antibody (70R-3377)

GPR87 antibody (70R-3377) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR87 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPR87 antibody (70R-3377) | GPR87 antibody (70R-3377) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors