GPRASP2 antibody (70R-4144)

Rabbit polyclonal GPRASP2 antibody raised against the middle region of GPRASP2

Synonyms Polyclonal GPRASP2 antibody, Anti-GPRASP2 antibody, GPRASP 2, G Protein-Coupled Receptor Associated Sorting Protein 2 antibody, FLJ37327 antibody, GPRASP-2, GPRASP2, GPRASP 2 antibody, GASP2 antibody, GPRASP-2 antibody, FLJ35662 antibody
Specificity GPRASP2 antibody was raised against the middle region of GPRASP2
Cross Reactivity Human
Applications WB
Immunogen GPRASP2 antibody was raised using the middle region of GPRASP2 corresponding to a region with amino acids EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ
Assay Information GPRASP2 Blocking Peptide, catalog no. 33R-2662, is also available for use as a blocking control in assays to test for specificity of this GPRASP2 antibody


Western Blot analysis using GPRASP2 antibody (70R-4144)

GPRASP2 antibody (70R-4144) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPRASP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM14A protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GPRASP2 antibody (70R-4144) | GPRASP2 antibody (70R-4144) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors