GPSM2 antibody (70R-2234)

Rabbit polyclonal GPSM2 antibody

Synonyms Polyclonal GPSM2 antibody, Anti-GPSM2 antibody, Ags3-Like C. Elegans antibody, LGN antibody, Pins antibody, G-Protein Signaling Modulator 2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
Assay Information GPSM2 Blocking Peptide, catalog no. 33R-10101, is also available for use as a blocking control in assays to test for specificity of this GPSM2 antibody


Immunohistochemical staining using GPSM2 antibody (70R-2234)

GPSM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPSM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GPSM2 antibody (70R-2234) | GPSM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GPSM2 antibody (70R-2234) | GPSM2 antibody (70R-2234) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors