GPSN2 antibody (70R-7016)

Rabbit polyclonal GPSN2 antibody raised against the middle region of GPSN2

Synonyms Polyclonal GPSN2 antibody, Anti-GPSN2 antibody, Glycoprotein Synaptic 2 antibody, SC2 antibody, TER antibody
Specificity GPSN2 antibody was raised against the middle region of GPSN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR
Assay Information GPSN2 Blocking Peptide, catalog no. 33R-7077, is also available for use as a blocking control in assays to test for specificity of this GPSN2 antibody

Images

Western Blot analysis using GPSN2 antibody (70R-7016)

GPSN2 antibody (70R-7016) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPSN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPSN2 antibody (70R-7016) | GPSN2 antibody (70R-7016) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors