GPT antibody (70R-1215)

Rabbit polyclonal GPT antibody

Synonyms Polyclonal GPT antibody, Anti-GPT antibody, Alanine Aminotransferase antibody, ALT1 antibody, AAT1 antibody, Glutamic-Pyruvate Transaminase antibody, GPT1 antibody
Cross Reactivity Human
Applications WB
Immunogen GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids CGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAI
Assay Information GPT Blocking Peptide, catalog no. 33R-1697, is also available for use as a blocking control in assays to test for specificity of this GPT antibody


Immunohistochemical staining using GPT antibody (70R-1215)

GPT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GPT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GPT antibody (70R-1215) | GPT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GPT antibody (70R-1215) | GPT antibody (70R-1215) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors