GPX4 antibody (70R-2447)

Rabbit polyclonal GPX4 antibody

Synonyms Polyclonal GPX4 antibody, Anti-GPX4 antibody, snPHGPx antibody, MCSP antibody, Glutathione Peroxidase 4 antibody, Phospholipid Hydroperoxidase antibody, PHGPx antibody, snGPx antibody
Cross Reactivity Human
Applications WB
Immunogen GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Assay Information GPX4 Blocking Peptide, catalog no. 33R-7765, is also available for use as a blocking control in assays to test for specificity of this GPX4 antibody


Immunohistochemical staining using GPX4 antibody (70R-2447)

GPX4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPX4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GPX4 antibody (70R-2447) | GPX4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GPX4 antibody (70R-2447) | GPX4 antibody (70R-2447) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using GPX4 antibody (70R-2447) | GPX4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors