GRAMD2 antibody (70R-6309)

Rabbit polyclonal GRAMD2 antibody raised against the middle region of GRAMD2

Synonyms Polyclonal GRAMD2 antibody, Anti-GRAMD2 antibody, GRAMD-2 antibody, GRAMD-2, GRAMD2, GRAMD 2, GRAMD 2 antibody, Gram Domain Containing 2 antibody
Specificity GRAMD2 antibody was raised against the middle region of GRAMD2
Cross Reactivity Human
Applications WB
Immunogen GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF
Assay Information GRAMD2 Blocking Peptide, catalog no. 33R-5276, is also available for use as a blocking control in assays to test for specificity of this GRAMD2 antibody

Images

Western Blot analysis using GRAMD2 antibody (70R-6309)

GRAMD2 antibody (70R-6309) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRAMD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GRAMD2 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GRAMD2 antibody (70R-6309) | GRAMD2 antibody (70R-6309) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors