GRAP antibody (70R-3703)

Rabbit polyclonal GRAP antibody raised against the middle region of GRAP

Synonyms Polyclonal GRAP antibody, Anti-GRAP antibody, Grb2-Related Adaptor Protein antibody, MGC64880 antibody
Specificity GRAP antibody was raised against the middle region of GRAP
Cross Reactivity Human
Applications WB
Immunogen GRAP antibody was raised using the middle region of GRAP corresponding to a region with amino acids KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD
Assay Information GRAP Blocking Peptide, catalog no. 33R-4634, is also available for use as a blocking control in assays to test for specificity of this GRAP antibody

Images

Western Blot analysis using GRAP antibody (70R-3703)

GRAP antibody (70R-3703) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the GRB2/Sem5/Drk family. This member functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GRAP antibody (70R-3703) | GRAP antibody (70R-3703) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors