GRK4 antibody (70R-3123)

Rabbit polyclonal GRK4 antibody raised against the middle region of GRK4

Synonyms Polyclonal GRK4 antibody, Anti-GRK4 antibody, GRK 4, IT11 antibody, GPRK4 antibody, GRK 4 antibody, GRK4a antibody, G Protein-Coupled Receptor Kinase 4 antibody, GRK4, GPRK2L antibody, GRK-4 antibody, GRK-4
Specificity GRK4 antibody was raised against the middle region of GRK4
Cross Reactivity Human
Applications WB
Immunogen GRK4 antibody was raised using the middle region of GRK4 corresponding to a region with amino acids QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY
Assay Information GRK4 Blocking Peptide, catalog no. 33R-7734, is also available for use as a blocking control in assays to test for specificity of this GRK4 antibody


Western Blot analysis using GRK4 antibody (70R-3123)

GRK4 antibody (70R-3123) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRK4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GRK4 antibody (70R-3123) | GRK4 antibody (70R-3123) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors