GRK5 antibody (70R-5734)

Rabbit polyclonal GRK5 antibody raised against the middle region of GRK5

Synonyms Polyclonal GRK5 antibody, Anti-GRK5 antibody, GRK 5, GRK5, GPRK5 antibody, GRK -5 antibody, GRK -5, G Protein-Coupled Receptor Kinase 5 antibody, GRK 5 antibody
Specificity GRK5 antibody was raised against the middle region of GRK5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GRK5 antibody was raised using the middle region of GRK5 corresponding to a region with amino acids FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG
Assay Information GRK5 Blocking Peptide, catalog no. 33R-3133, is also available for use as a blocking control in assays to test for specificity of this GRK5 antibody

Images

Western Blot analysis using GRK5 antibody (70R-5734)

GRK5 antibody (70R-5734) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GRK5 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GRK5 antibody (70R-5734) | GRK5 antibody (70R-5734) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors