Growth Hormone 2 antibody (70R-6227)

Rabbit polyclonal Growth Hormone 2 antibody raised against the middle region of GH2

Synonyms Polyclonal Growth Hormone 2 antibody, Anti-Growth Hormone 2 antibody, GHV antibody, hGH-V antibody, GH-V antibody, GH2 antibody, GHL antibody
Specificity Growth Hormone 2 antibody was raised against the middle region of GH2
Cross Reactivity Human
Applications WB
Immunogen Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG
Assay Information Growth Hormone 2 Blocking Peptide, catalog no. 33R-4888, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody

Images

Western Blot analysis using Growth Hormone 2 antibody (70R-6227)

Growth Hormone 2 antibody (70R-6227) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Growth Hormone 2 antibody (70R-6227) | Growth Hormone 2 antibody (70R-6227) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors