GRSF1 antibody (70R-4773)

Rabbit polyclonal GRSF1 antibody raised against the middle region of GRSF1

Synonyms Polyclonal GRSF1 antibody, Anti-GRSF1 antibody, G-Rich Rna Sequence Binding Factor 1 antibody, FLJ13125 antibody
Specificity GRSF1 antibody was raised against the middle region of GRSF1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
Assay Information GRSF1 Blocking Peptide, catalog no. 33R-4139, is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody

Images

Western Blot analysis using GRSF1 antibody (70R-4773)

GRSF1 antibody (70R-4773) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRSF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GRSF1 antibody (70R-4773) | GRSF1 antibody (70R-4773) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors