GSG1 antibody (70R-7537)

Rabbit polyclonal GSG1 antibody raised against the C terminal of GSG1

Synonyms Polyclonal GSG1 antibody, Anti-GSG1 antibody, MGC111023 antibody, MGC3146 antibody, GSG-1 antibody, GSG 1, GSG-1, Germ Cell Associated 1 antibody, GSG 1 antibody, GSG1
Specificity GSG1 antibody was raised against the C terminal of GSG1
Cross Reactivity Human
Applications WB
Immunogen GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Assay Information GSG1 Blocking Peptide, catalog no. 33R-9567, is also available for use as a blocking control in assays to test for specificity of this GSG1 antibody

Images

Western Blot analysis using GSG1 antibody (70R-7537)

GSG1 antibody (70R-7537) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GSG1 antibody (70R-7537) | GSG1 antibody (70R-7537) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors