GSG2 Blocking Peptide (33R-10406)

A synthetic peptide for use as a blocking control in assays to test for specificity of GSG2 antibody, catalog no. 70R-10107

Synonyms GSG2 control peptide, GSG2 antibody Blocking Peptide, Anti-GSG2 Blocking Peptide, germ cell associated 2, haspin Blocking Peptide, HASPIN Blocking Peptide, GSG2, GSG-2, GSG 2, GSG-2 Blocking Peptide, GSG 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRES
Molecular Weight 88 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSG2 is required for normal alignment of chromosomes at metaphase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors