GSPT2 antibody (70R-3859)

Rabbit polyclonal GSPT2 antibody raised against the middle region of GSPT2

Synonyms Polyclonal GSPT2 antibody, Anti-GSPT2 antibody, G1 To S Phase Transition 2 antibody, GST2 antibody, eRF3b antibody, FLJ10441 antibody
Specificity GSPT2 antibody was raised against the middle region of GSPT2
Cross Reactivity Human
Applications WB
Immunogen GSPT2 antibody was raised using the middle region of GSPT2 corresponding to a region with amino acids GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT
Assay Information GSPT2 Blocking Peptide, catalog no. 33R-3163, is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody


Western Blot analysis using GSPT2 antibody (70R-3859)

GSPT2 antibody (70R-3859) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSPT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GSPT2 antibody (70R-3859) | GSPT2 antibody (70R-3859) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors