GSTM1 antibody (70R-5348)

Rabbit polyclonal GSTM1 antibody raised against the N terminal of GSTM1

Synonyms Polyclonal GSTM1 antibody, Anti-GSTM1 antibody, GST1 antibody, MU antibody, GSTM 1, Glutathione S-Transferase M1 antibody, GSTM-1 antibody, GSTM-1, GTH4 antibody, GSTM1a-1a antibody, GSTM 1 antibody, GSTM1-1 antibody, MGC26563 antibody, GSTM1b-1b antibody, H-B antibody, GSTM1, GTM1 antibody, MU-1 antibody
Specificity GSTM1 antibody was raised against the N terminal of GSTM1
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen GSTM1 antibody was raised using the N terminal of GSTM1 corresponding to a region with amino acids KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI
Assay Information GSTM1 Blocking Peptide, catalog no. 33R-4498, is also available for use as a blocking control in assays to test for specificity of this GSTM1 antibody

Images

Western Blot analysis using GSTM1 antibody (70R-5348)

GSTM1 antibody (70R-5348) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GSTM1 antibody (70R-5348) | GSTM1 antibody (70R-5348) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors