GSTM3 antibody (70R-5232)

Rabbit polyclonal GSTM3 antibody

Synonyms Polyclonal GSTM3 antibody, Anti-GSTM3 antibody, GSTM-3, GTM3 antibody, MGC3310 antibody, MGC3704 antibody, GSTM3, GSTM 3, GST5 antibody, GSTM3-3 antibody, GSTM 3 antibody, GSTB antibody, GSTM-3 antibody, Glutathione S-Transferase M3 antibody
Cross Reactivity Human
Applications WB
Immunogen GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF
Assay Information GSTM3 Blocking Peptide, catalog no. 33R-8636, is also available for use as a blocking control in assays to test for specificity of this GSTM3 antibody

Images

Western Blot analysis using GSTM3 antibody (70R-5232)

GSTM3 antibody (70R-5232) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GSTM3 antibody (70R-5232) | GSTM3 antibody (70R-5232) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors