GSTO2 antibody (70R-2337)

Rabbit polyclonal GSTO2 antibody raised against the N terminal of GSTO2

Synonyms Polyclonal GSTO2 antibody, Anti-GSTO2 antibody, bA127L20.1 antibody, Glutathione S-Transferase Omega 2 antibody, GSTO 2 antibody, GSTO-2, GSTO 2, GSTO-2 antibody, GSTO2
Specificity GSTO2 antibody was raised against the N terminal of GSTO2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GSTO2 antibody was raised using the N terminal of GSTO2 corresponding to a region with amino acids VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV
Assay Information GSTO2 Blocking Peptide, catalog no. 33R-9654, is also available for use as a blocking control in assays to test for specificity of this GSTO2 antibody

Images

Western Blot analysis using GSTO2 antibody (70R-2337)

GSTO2 antibody (70R-2337) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTO2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GSTO2 antibody (70R-2337) | GSTO2 antibody (70R-2337) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors