GTPBP2 antibody (70R-3865)

Rabbit polyclonal GTPBP2 antibody raised against the N terminal of GTPBP2

Synonyms Polyclonal GTPBP2 antibody, Anti-GTPBP2 antibody, GTPBP-2, GTPBP 2 antibody, GTPBP2, Gtp Binding Protein 2 antibody, MGC74725 antibody, GTPBP-2 antibody, GTPBP 2
Specificity GTPBP2 antibody was raised against the N terminal of GTPBP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH
Assay Information GTPBP2 Blocking Peptide, catalog no. 33R-3185, is also available for use as a blocking control in assays to test for specificity of this GTPBP2 antibody


Western Blot analysis using GTPBP2 antibody (70R-3865)

GTPBP2 antibody (70R-3865) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GTPBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GTPBP2 antibody (70R-3865) | GTPBP2 antibody (70R-3865) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors