GUCY1B3 antibody (70R-5802)

Rabbit polyclonal GUCY1B3 antibody raised against the N terminal of GUCY1B3

Synonyms Polyclonal GUCY1B3 antibody, Anti-GUCY1B3 antibody, GC-SB3 antibody, Guanylate Cyclase 1 Soluble Beta 3 antibody, GUC1B3 antibody, GC-S-beta-1 antibody, GUCB3 antibody, GUCSB3 antibody
Specificity GUCY1B3 antibody was raised against the N terminal of GUCY1B3
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen GUCY1B3 antibody was raised using the N terminal of GUCY1B3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV
Assay Information GUCY1B3 Blocking Peptide, catalog no. 33R-5041, is also available for use as a blocking control in assays to test for specificity of this GUCY1B3 antibody

Images

Western Blot analysis using GUCY1B3 antibody (70R-5802)

GUCY1B3 antibody (70R-5802) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GUCY1B3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GUCY1B3 antibody (70R-5802) | GUCY1B3 antibody (70R-5802) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors