Guk1 Blocking Peptide (33R-10393)

A synthetic peptide for use as a blocking control in assays to test for specificity of Guk1 antibody, catalog no. 70R-9262

Synonyms Guk1 control peptide, Guk1 antibody Blocking Peptide, Anti-Guk1 Blocking Peptide, guanylate kinase 1 Blocking Peptide, Guk1, Guk-1, Guk 1, Guk-1 Blocking Peptide, Guk 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Guk1 is essential for recycling GMP and indirectly, cGMP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors