HAMP antibody (70R-6236)

Rabbit polyclonal HAMP antibody raised against the N terminal of HAMP

Synonyms Polyclonal HAMP antibody, Anti-HAMP antibody, LEAP1 antibody, Hepcidin Antimicrobial Peptide antibody, HEPC antibody, LEAP-1 antibody, HFE2B antibody
Specificity HAMP antibody was raised against the N terminal of HAMP
Cross Reactivity Human
Applications WB
Immunogen HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
Assay Information HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody

Images

Western Blot analysis using HAMP antibody (70R-6236)

HAMP antibody (70R-6236) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAMP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HAMP antibody (70R-6236) | HAMP antibody (70R-6236) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors